PDB entry 4kpl

View 4kpl on RCSB PDB site
Description: Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg,d-mannonate and 2-keto-3-deoxy-d-gluconate
Class: hydrolase
Keywords: Enolase fold, D-MANNONATE DEHYDRATASE, D-MANNONATE, 2-KETO-3-DEOXY-D-GLUCONATE, hydrolase
Deposited on 2013-05-13, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4kpla1, d4kpla2, d4kpla3
  • Chain 'B':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d4kplb1, d4kplb2, d4kplb3
  • Chain 'C':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4kplc1, d4kplc2, d4kplc3
  • Chain 'D':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d4kpld1, d4kpld2, d4kpld3
  • Chain 'E':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d4kple1, d4kple2, d4kple3
  • Chain 'F':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d4kplf1, d4kplf2, d4kplf3
  • Chain 'G':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d4kplg1, d4kplg2, d4kplg3
  • Chain 'H':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (Start-404)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d4kplh1, d4kplh2, d4kplh3
  • Heterogens: CS2, CL, MG, KDG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4kplA (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplA (A:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4kplB (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplB (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgieepadsslpaehvwstekylnhapk
    lfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlire
    htttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfh
    gptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgv
    dideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4kplC (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplC (C:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaav
    rerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttp
    laigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdl
    spvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdidee
    laakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4kplD (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplD (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4kplE (E:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplE (E:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgyepadsslpaehvwstekylnhapkl
    faavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireh
    tttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhg
    ptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvd
    ideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4kplF (F:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplF (F:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiedsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4kplG (G:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplG (G:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4kplH (H:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4kplH (H:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw