PDB entry 4kmp

View 4kmp on RCSB PDB site
Description: Structure of XIAP-BIR3 and inhibitor
Class: ligase/ligase inhibitor
Keywords: apoptosis, XIAP-BIR3, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-05-08, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.165
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (5-97)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d4kmpa1, d4kmpa2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (5-97)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d4kmpb1, d4kmpb2
  • Heterogens: ZN, GT6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kmpA (A:)
    adshmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdw
    kpsedpweqhakwypgckylleqkgqeyinnihlthsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4kmpB (B:)
    adshmlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdw
    kpsedpweqhakwypgckylleqkgqeyinnihlthsl