PDB entry 4ki7

View 4ki7 on RCSB PDB site
Description: Design and structural analysis of aromatic inhibitors of type II dehydroquinase from Mycobacterium tuberculosis - compound 41c [3-hydroxy-5-(3-nitrophenoxy)benzoic acid]
Class: Lyase/Lyase Inhibitor
Keywords: DHQase, dehydratase, Lyase-Lyase Inhibitor complex
Deposited on 2013-05-01, released 2014-05-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ki7a_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 3-dehydroquinate dehydratase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroD, aroK, aroQ, MT2612, MTCY159.19, Rv2537c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4Z6 (6-End)
      • expression tag (0-5)
  • Heterogens: 1R2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ki7A (A:)
    lyfqshmselivnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsd
    seaqlldwihqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrr
    hsylspiatgvivglgiqgyllalrylaehvgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ki7A (A:)
    livnvingpnlgrlgggtthdelvaliereaaelglkavvrqsdseaqlldwihqaadaa
    epvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivglg
    iqgyllalrylaeh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.