PDB entry 4k2s

View 4k2s on RCSB PDB site
Description: Crystal structure of the mutant P317A of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Class: isomerase
Keywords: Enolase fold, D-MANNONATE DEHYDRATASE, D-Gluconate, ISOMERASE
Deposited on 2013-04-09, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (1-2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sa1, d4k2sa2, d4k2sa3
  • Chain 'B':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sb1, d4k2sb2, d4k2sb3
  • Chain 'C':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (1-2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sc1, d4k2sc2, d4k2sc3
  • Chain 'D':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sd1, d4k2sd2, d4k2sd3
  • Chain 'E':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (1-2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2se1, d4k2se2, d4k2se3
  • Chain 'F':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sf1, d4k2sf2, d4k2sf3
  • Chain 'G':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sg1, d4k2sg2, d4k2sg3
  • Chain 'H':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (1-2)
      • engineered mutation (316)
    Domains in SCOPe 2.07: d4k2sh1, d4k2sh2, d4k2sh3
  • Heterogens: GCO, MG, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k2sA (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sA (A:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgiettygvasslpaehvwstekylnh
    apklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrl
    irehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrt
    gfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespg
    hgvdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k2sB (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sB (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiettygsslpaehvwstekylnhapk
    lfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlire
    htttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfh
    gatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgv
    dideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k2sC (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sC (C:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgiettygvasslpaehvwstekylnh
    apklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrl
    irehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrt
    gfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespg
    hgvdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k2sD (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sD (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiettygvsslpaehvwstekylnhap
    klfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlir
    ehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgf
    hgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghg
    vdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k2sE (E:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sE (E:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgiettygvslpaehvwstekylnhap
    klfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlir
    ehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgf
    hgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghg
    vdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4k2sF (F:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sF (F:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiettygvslpaehvwstekylnhapk
    lfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlire
    htttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfh
    gatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgv
    dideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4k2sG (G:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sG (G:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgiettygvdsslpaehvwstekylnha
    pklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrli
    rehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtg
    fhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespgh
    gvdideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4k2sH (H:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k2sH (H:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgiettygvepadsslpaehvwsteky
    lnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqes
    lrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyh
    vrtgfhgatdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflage
    spghgvdideelaakypyeraslpvnrledgtlwhw