PDB entry 4jfn

View 4jfn on RCSB PDB site
Description: Crystal structure of the N-terminal, growth factor-like domain of the amyloid precursor protein bound to copper
Class: metal binding protein
Keywords: Alzheimer's disease, GFLD, APP, Growth factor-like domain, copper binding, METAL BINDING PROTEIN
Deposited on 2013-02-28, released 2014-07-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, A4, AD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4jfna_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jfnA (A:)
dgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqi
tnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefvsdallvpdkckflhqermd
vcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv

    Sequence, based on observed residues (ATOM records): (download) 
    >4jfnA (A:)
dgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqi
tnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefv