PDB entry 4j25

View 4j25 on RCSB PDB site
Description: Crystal structure of a Pseudomonas putida prolyl-4-hydroxylase (P4H)
Class: oxidoreductase
Keywords: 2-oxoglutarate oxygenase, oxygen sensing, double-stranded beta helix, jellyroll fold, prolyl-4-hydroxylase, OXIDOREDUCTASE
Deposited on 2013-02-04, released 2014-02-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1 (23-End)
    • expression tag (22)
  Domains in SCOPe 2.04: d4j25a_
• Chain 'B':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1 (23-End)
    • expression tag (22)
• Chain 'C':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1 (23-End)
    • expression tag (22)
• Chain 'D':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1 (23-228)
    • expression tag (21-22)
• Chain 'E':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1
• Chain 'F':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1
• Chain 'G':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1
• Chain 'H':
  Compound: Putative uncharacterized protein
  Species: Pseudomonas putida [TaxId:160488]
  Gene: PP_5159
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q88CM1
• Heterogens: MN, OGA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4j25A (A:)
  mgsshhhhhhssglvprgshmashispehpmlaavvddlathgwsqqahflpadlvrala
  aecrrrdaegelnpagvgrgatqevretirgdqiqwidpgqaeacdqylaamdqlrlain
  qglflgledfechfalyppgafyrrhldrfrdddrrmvsavlylnegwqphdggqlrmfl
  adgvehdvepvagclvvflsgevphevlpagrerlsltgwfrrrgndpf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4j25A (A:)
  shispehpmlaavvddlathgwsqqahflpadlvralaaecrrrdaiqwidpgqaeacdq
  ylaamdqlrlainqglflgledfechfalyppgafyrrhldrfrdddrrmvsavlylneg
  wqphdggqlrmfladgvehdvepvagclvvflsgevphevlpagrerlsltgwfrrrgnd
  p
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.