PDB entry 4id1

View 4id1 on RCSB PDB site
Description: HIV-1 Integrase Catalytic Core Domain Complexed with Allosteric Inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: HIV Integrase, CCD, DDE motif, dimer interface, allosteric inhibitor, quinoline, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-12-11, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gag-Pol polyprotein
    Species: Human immunodeficiency virus type 1 [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (135)
    Domains in SCOPe 2.07: d4id1a_
  • Heterogens: LF0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4id1A (A:)
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnkkrkggiggysagerivdiiatdiqtke

    Sequence, based on observed residues (ATOM records): (download) 
    >4id1A (A:)
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgggysagerivdiiatdiq