PDB entry 4hy5

View 4hy5 on RCSB PDB site
Description: Crystal structure of cIAP1 BIR3 bound to T3256336
Class: ligase/ligase inhibitor
Keywords: IAP family, BIR repeats, CARD domain, RING-type zinc finger, LIGASE-LIGASE INHIBITOR complex
Deposited on 2012-11-13, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (Start-114)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d4hy5a1, d4hy5a2
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4hy5b_
  • Heterogens: ZN, 1AQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4hy5A (A:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4hy5A (A:)
gssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwe
sgddpwvehakwfprceflirmkgqefvdeiqgry

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4hy5B (B:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4hy5B (B:)
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry