PDB entry 4hvy

View 4hvy on RCSB PDB site
Description: A thermostable variant of human NUDT18 NUDIX domain obtained by Hot Colony Filtration
Class: hydrolase
Keywords: hydrolase, thermostability, directed evolution, Hot-CoFi, Hot Colony Filtration
Deposited on 2012-11-07, released 2014-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-01, with a file datestamp of 2013-12-27.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.169
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate-linked moiety X motif 18
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6ZVK8
      • engineered mutation (20)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d4hvya_
  • Heterogens: GOL, MG, SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4hvyA (A:)
msapageppapvrlrknvcymvlavflseqdevlliqeakrecrgswylpagrmepgeti
vealqrvvkeeaglhcepetllsveergpswvrfvflarptggilktskeadaeslqaaw
yprtslptplrahdilhlvelaaqyrqqarhplilahhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4hvyA (A:)
rknvcymvlavflseqdevlliqeakrecrgswylpagrmepgetivealqrvvkeeagl
hcepetllsveergpswvrfvflarptggilktskeadaeslqaawyprtslptplrahd
ilhlvelaaqyrqqa