PDB entry 4gcr

View 4gcr on RCSB PDB site
Description: structure of the bovine eye lens protein gamma-b (gamma-II)-crystallin at 1.47 angstroms
Class: eye lens protein
Keywords: eye lens protein
Deposited on 1992-04-02, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.181
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma-b crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gcra1, d4gcra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4gcrA (A:)
    gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
    dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
    vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy