PDB entry 4g05

View 4g05 on RCSB PDB site
Description: The crystal structures of several mutants of Pleurotus eryngii versatile peroxidase
Class: oxidoreductase
Keywords: lignin peroxidase, lignin degradation, aromatic-substrate binding, oxidoreductase
Deposited on 2012-07-09, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.174
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: versatile peroxidase vpl2
    Species: Pleurotus eryngii [TaxId:5323]
    Gene: vpl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94753 (0-316)
      • engineered mutation (139)
      • engineered mutation (190)
    Domains in SCOPe 2.07: d4g05a_
  • Heterogens: HEM, CA, JZ3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4g05A (A:)
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpalta