PDB entry 4f2m

View 4f2m on RCSB PDB site
Description: Crystal structure of a TGEV coronavirus Spike fragment in complex with the TGEV neutralizing monoclonal antibody 1AF10
Class: viral protein/immune system
Keywords: beta-barrel, immunoglobulin, virus entry, virus neutralization, cellular receptor, aminopeptidase N, glycosylation, virus membrane, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-05-08, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody 1AF10, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F2M (0-End)
  • Chain 'B':
    Compound: monoclonal antibody 1AF10, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F2M (0-End)
    Domains in SCOPe 2.07: d4f2mb1, d4f2mb2
  • Chain 'C':
    Compound: monoclonal antibody 1AF10, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F2M (0-End)
  • Chain 'D':
    Compound: monoclonal antibody 1AF10, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F2M (0-End)
    Domains in SCOPe 2.07: d4f2md1, d4f2md2
  • Chain 'E':
    Compound: Spike protein
    Species: TGEV virulent Purdue [TaxId:398812]
    Gene: S
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PKZ5 (Start-194)
      • expression tag (195-198)
  • Chain 'F':
    Compound: Spike protein
    Species: TGEV virulent Purdue [TaxId:398812]
    Gene: S
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PKZ5 (Start-194)
      • expression tag (195-198)
  • Heterogens: ACY, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f2mB (B:)
    dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
    rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2mB (B:)
    dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
    rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f2mD (D:)
    dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
    rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f2mD (D:)
    dilltqspailsvspgervslscrasqsigtsihwyqqrtngsprplikyasesisgips
    rfsgsgsgtdftlninsvesediadyfcqqtdswpttfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.