PDB entry 4e8g

View 4e8g on RCSB PDB site
Description: Crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg
Class: isomerase
Keywords: Putative Racemase, NYSGRC, Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, ISOMERASE
Deposited on 2012-03-20, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1B198 (23-390)
      • expression tag (22)
    Domains in SCOPe 2.07: d4e8ga1, d4e8ga2, d4e8ga3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_1187
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1B198 (23-390)
      • expression tag (22)
    Domains in SCOPe 2.07: d4e8gb1, d4e8gb2, d4e8gb3
  • Heterogens: MG, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e8gA (A:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8gA (A:)
    mkiaeihvyahdlslqttlvkivadsglagwgetcpvgptyapshalgaraalaemapgl
    iganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrvadllggvaaervpsy
    yatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwerirgtgtrlavdg
    nrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyldesgedlstviraa
    gqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiiaaacthigatvqpr
    lnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfgppvasfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e8gB (B:)
    mhhhhhhssgvdlgtenlyfqsmkiaeihvyahdlpvkdgpytiasstvwslqttlvkiv
    adsglagwgetcpvgptyapshalgaraalaemapgliganplqplvlrrrmdgllcghn
    yakaaidiaaydlmgkhygvrvadllggvaaervpsyyatgigqpdeiariaaekvaegf
    prlqikiggrpveidietvrkvwerirgtgtrlavdgnrslpsrdalrlsrecpeipfvl
    eqpcntleeiaairgrvqhgiyldesgedlstviraagqglcdgfgmkltrigglqqmaa
    frdicearalphscddawggdiiaaacthigatvqprlnegvwvaqpyiaqpydeengir
    iagghidlpkgpglgitpdeslfgppvasfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8gB (B:)
    mkiaeihvyahdlpvkdgpytistvwslqttlvkivadsglagwgetcpvgptyapshal
    garaalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrvad
    llggvaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwe
    rirgtgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyld
    esgedlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiia
    aacthigatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfg
    ppvasfs