PDB entry 4dp1

View 4dp1 on RCSB PDB site
Description: The 1.35 Angstrom crystal structure of reduced (CuI) poplar plastocyanin B at pH 4.0
Class: electron transport
Keywords: membrane, thylakoid, transit peptide, plastocyanin-like domain, copper-binding, ELECTRON TRANSPORT
Deposited on 2012-02-13, released 2013-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Plastocyanin B, chloroplastic
  Species: Populus nigra [TaxId:3691]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11970 (0-98)
  Domains in SCOPe 2.07: d4dp1x_
• Heterogens: CU1, SO4, GOL, ACT, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dp1X (X:)
  vdvllgaddgslafvpsefsvpagekivfknnagfphnvlfdedavpsgvdvskismsee
  dllnakgetfevalsdkgeytfycsphqgagmvgkvivn