PDB entry 4dc7

View 4dc7 on RCSB PDB site
Description: Crystal Structure of Myoglobin Exposed to Excessive SONICC Imaging Laser Dose.
Class: oxygen storage
Keywords: sonicc, oxygen storage
Deposited on 2012-01-17, released 2013-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68082 (0-151)
  Domains in SCOPe 2.03: d4dc7a_
• Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dc7A (A:)
  glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
  lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
  gdfgadaqgamtkalelfrndiaakykelgfq