PDB entry 4cz6

View 4cz6 on RCSB PDB site
Description: Truncated tetramerization domain of zebrafish p53 (crystal form II)
Class: antitumor protein
Keywords: antitumor protein, p53 family, tumor suppressor, transcription factor, protein evolution
Deposited on 2014-04-16, released 2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.15003
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellular tumor antigen p53
  Species: Danio rerio [TaxId:7955]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P79734 (3-End)
    • expression tag (2)
  Domains in SCOPe 2.07: d4cz6a1, d4cz6a2
• Chain 'B':
  Compound: Cellular tumor antigen p53
  Species: Danio rerio [TaxId:7955]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P79734 (Start-32)
  Domains in SCOPe 2.07: d4cz6b_
• Chain 'C':
  Compound: Cellular tumor antigen p53
  Species: Danio rerio [TaxId:7955]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P79734
  Domains in SCOPe 2.07: d4cz6c_
• Chain 'D':
  Compound: Cellular tumor antigen p53
  Species: Danio rerio [TaxId:7955]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P79734 (3-32)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d4cz6d1, d4cz6d2
• Heterogens: PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4cz6A (A:)
  ggseeiftlqvrgreryeilkklndslelsdvv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cz6A (A:)
  seeiftlqvrgreryeilkklndslelsdv
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4cz6B (B:)
  ggseeiftlqvrgreryeilkklndslelsdvv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cz6B (B:)
  eiftlqvrgreryeilkklndslelsdvv
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >4cz6C (C:)
  ggseeiftlqvrgreryeilkklndslelsdvv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cz6C (C:)
  eiftlqvrgreryeilkklndslelsdv
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4cz6D (D:)
  ggseeiftlqvrgreryeilkklndslelsdvv