PDB entry 4cz6
View 4cz6 on RCSB PDB site
Description: Truncated tetramerization domain of zebrafish p53 (crystal form II)
Class: antitumor protein
Keywords: antitumor protein, p53 family, tumor suppressor, transcription factor, protein evolution
Deposited on
2014-04-16, released
2014-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated
2014-09-17, with a file datestamp of
2014-09-12.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.15003
AEROSPACI score: 0.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellular tumor antigen p53
Species: Danio rerio [TaxId:7955]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4cz6a1, d4cz6a2 - Chain 'B':
Compound: Cellular tumor antigen p53
Species: Danio rerio [TaxId:7955]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4cz6b_ - Chain 'C':
Compound: Cellular tumor antigen p53
Species: Danio rerio [TaxId:7955]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4cz6c_ - Chain 'D':
Compound: Cellular tumor antigen p53
Species: Danio rerio [TaxId:7955]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4cz6d1, d4cz6d2 - Heterogens: PEG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4cz6A (A:)
ggseeiftlqvrgreryeilkklndslelsdvv
Sequence, based on observed residues (ATOM records): (download)
>4cz6A (A:)
seeiftlqvrgreryeilkklndslelsdv
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4cz6B (B:)
ggseeiftlqvrgreryeilkklndslelsdvv
Sequence, based on observed residues (ATOM records): (download)
>4cz6B (B:)
eiftlqvrgreryeilkklndslelsdvv
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4cz6C (C:)
ggseeiftlqvrgreryeilkklndslelsdvv
Sequence, based on observed residues (ATOM records): (download)
>4cz6C (C:)
eiftlqvrgreryeilkklndslelsdv
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4cz6D (D:)
ggseeiftlqvrgreryeilkklndslelsdvv