PDB entry 4cdx

View 4cdx on RCSB PDB site
Description: Crystal structure of human Enterovirus 71 in complex with the uncoating inhibitor GPP12
Class: virus
Keywords: virus, hand-foot-and-mouth disease, enterovirus uncoating, inhibitor
Deposited on 2013-11-07, released 2014-02-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.27
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vp2
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp3
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4cdxc_
  • Chain 'D':
    Compound: vp4
    Species: ENTEROVIRUS A71 [TaxId:39054]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: JF0, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cdxC (C:)
    gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
    natslmerlrfpvsaqagkgelcavfradpgrngpwqstllgqlcgyytqwsgslevtfm
    ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
    ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdasdilqtgt
    iq
    

  • Chain 'D':
    No sequence available.