PDB entry 4ca4

View 4ca4 on RCSB PDB site
Description: Crystal structure of FimH lectin domain with the Tyr48Ala mutation, in complex with heptyl alpha-D-mannopyrannoside
Class: cell adhesion
Keywords: cell adhesion, bacterial adhesin, type 1 fimbriae, urinary tract infection, variable immunoglobulin fold, heptyl mannose, fimh antagonist
Deposited on 2013-10-06, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2IC68 (0-157)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4ca4a_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2IC68 (0-157)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d4ca4b_
  • Heterogens: KGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ca4A (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ca4B (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndapetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt