PDB entry 4c83

View 4c83 on RCSB PDB site
Description: Crystal Structure of the IgG2a LPT3 in complex with an 8-sugar inner core analogue of Neisseria meningitidis
Class: immune system
Keywords: immune system, lipooligosaccharides, antibodies, antigen-antibody complex
Deposited on 2013-09-29, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lpt3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4C83 (Start-219)
  • Chain 'B':
    Compound: lpt3 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4C83 (0-213)
    Domains in SCOPe 2.07: d4c83b1, d4c83b2
  • Chain 'C':
    Compound: lpt3 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4C83 (Start-219)
  • Chain 'D':
    Compound: lpt3 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4C83 (Start-213)
    Domains in SCOPe 2.07: d4c83d1, d4c83d2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4c83B (B:)
    qivlsqspaimsaspgekvtmtcsasssvrymhwyqqksgtspkrwiydtsklasgvptr
    fsgsgsgtsyslpissmeaedgasyycqqwngyppltfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4c83D (D:)
    qivlsqspaimsaspgekvtmtcsasssvrymhwyqqksgtspkrwiydtsklasgvptr
    fsgsgsgtsyslpissmeaedgasyycqqwngyppltfgggtklemkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4c83D (D:)
    ivlsqspaimsaspgekvtmtcsasssvrymhwyqqksgtspkrwiydtsklasgvptrf
    sgsgsgtsyslpissmeaedgasyycqqwngyppltfgggtklemkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec