PDB entry 4bv7

View 4bv7 on RCSB PDB site
Description: Identification of small molecule inhibitors selective for apo(a) kringles KIV-7, KIV-10 and KV.
Class: hydrolase
Keywords: hydrolase, lipoprotein(a), cardiovascular disease, drug discovery, optical biosensors
Deposited on 2013-06-25, released 2014-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16782
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein(a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (0-78)
      • engineered mutation (74)
    Domains in SCOPe 2.07: d4bv7a_
  • Heterogens: ACT, BV7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4bv7A (A:)
    qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
    wcftmdpsirweycaltrc