PDB entry 4att

View 4att on RCSB PDB site
Description: FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to a propynyl para methoxy phenyl
Class: sugar binding protein
Keywords: sugar binding protein, fimbriae, variable immunoglobulin fold, urinary tract infection
Deposited on 2012-05-09, released 2013-05-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1511
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FimH
  Species: ESCHERICHIA COLI [TaxId:364106]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2IC68 (0-157)
  Domains in SCOPe 2.04: d4atta_
• Heterogens: HNV, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4attA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt