PDB entry 4ar5

View 4ar5 on RCSB PDB site
Description: X-ray crystallographic structure of the oxidised form perdeuterated Pyrococcus furiosus rubredoxin in D2O at 295K (in quartz capillary) to 1.00 Angstom resolution.
Class: electron transport
Keywords: electron transport, perdeuterated, ambient capillary
Deposited on 2012-04-20, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.1099
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ar5a_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ar5A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled