PDB entry 4a9z

View 4a9z on RCSB PDB site
Description: crystal structure of human p63 tetramerization domain
Class: transcription
Keywords: transcription
Deposited on 2011-11-30, released 2011-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.1967
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a9za_
  • Chain 'B':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a9zb_
  • Chain 'C':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4a9zd_
  • Heterogens: PE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4a9zA (A:)
gsddellylpvrgretyemllkikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiq
s

    Sequence, based on observed residues (ATOM records): (download) 
    >4a9zA (A:)
ddellylpvrgretyemllkikeslelmqylpqhtietyrqqqqqqh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4a9zB (B:)
gsddellylpvrgretyemllkikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiq
s

    Sequence, based on observed residues (ATOM records): (download) 
    >4a9zB (B:)
ddellylpvrgretyemllkikeslelmqylpqhtietyrqqqqq

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4a9zD (D:)
gsddellylpvrgretyemllkikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiq
s

    Sequence, based on observed residues (ATOM records): (download) 
    >4a9zD (D:)
ddellylpvrgretyemllkikeslelmqylpqhtietyrqqqq