PDB entry 3zy1

View 3zy1 on RCSB PDB site
Description: Crystal structure of the human p63 tetramerization domain
Class: transcription
Keywords: transcription, transcription factor, tetramerization domain, cell-cycle control
Deposited on 2011-08-16, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.23793
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zy1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zy1A (A:)
    gsdellylpvrgretyemllkikeslelmqylpqhtietyrqqqqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zy1A (A:)
    dellylpvrgretyemllkikeslelmqylpqhtietyrq