PDB entry 3wam

View 3wam on RCSB PDB site
Description: Crystal structure of human LC3C_8-125
Class: protein transport
Keywords: ubiquitin-like fold, autophagy, protein transport
Deposited on 2013-05-06, released 2013-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.174
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated proteins 1A/1B light chain 3C
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3wama_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3wamA (A:)
    gspsvrpfkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqelt
    mtqflsiirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3wamA (A:)
    rpfkqrkslairqeevagirakfpnkipvvverypretflppldktkflvpqeltmtqfl
    siirsrmvlrateafyllvnnkslvsmsatmaeiyrdykdedgfvymtyasqetf