PDB entry 3vym

View 3vym on RCSB PDB site
Description: Dimeric Hydrogenobacter thermophilus cytochrome c552
Class: electron transport
Keywords: Electron Transport
Deposited on 2012-09-28, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-552
  Species: Hydrogenobacter thermophilus [TaxId:608538]
  Gene: HTH_0988, Hydth_0984
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15452 (0-79)
  Domains in SCOPe 2.07: d3vyma_
• Heterogens: HEC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3vymA (A:)
  neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
  pqnvtdaeakqlaqwilsik