PDB entry 3usn

View 3usn on RCSB PDB site
Description: structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the thiadiazole inhibitor ipnu-107859, nmr, 1 structure
Class: hydrolase
Keywords: hydrolase, metalloprotease
Deposited on 1998-06-18, released 1999-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: stromelysin-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08254 (0-167)
  Domains in SCOPe 2.07: d3usna_
• Heterogens: ZN, CA, ATT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3usnA (A:)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp