PDB entry 3stk

View 3stk on RCSB PDB site
Description: Crystal Structure of human LFABP complex with two molecules of palmitic acid (holo-LFABP)
Class: lipid binding protein
Keywords: LFABP, Palmitic acid, Fatty acid binding, LIPID BINDING PROTEIN
Deposited on 2011-07-11, released 2011-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, liver
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP1, FABPL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07148 (4-129)
      • expression tag (3)
      • expression tag (130-131)
    Domains in SCOPe 2.07: d3stka1, d3stka2, d3stka3
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3stkA (A:)
magssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagsk
viqneftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgd
ivfkriskrigt

    Sequence, based on observed residues (ATOM records): (download) 
    >3stkA (A:)
ssfsgkyqlqsqenfeafmkaiglpeeliqkgkdikgvseivqngkhfkftitagskviq
neftvgeeceletmtgekvktvvqlegdnklvttfkniksvtelngdiitntmtlgdivf
kriskrigt