PDB entry 3sgw

View 3sgw on RCSB PDB site
Description: Crystal structure of ribose-5-phosphate isomerase B RpiB from Coccidioides immitis semi-covalently bound to malonic acid
Class: isomerase/isomerase inhibitor
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Valley Fever, Coccidioidomycosis immitis, pathogenic fungus, RpiB, dust-borne pathogen, iodoacetic acid, covalent inhibitor, ribulose-5-phosphate, ribose-5-phosphate, ISOMERASE, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2011-06-15, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribose 5-phosphate isomerase
  Species: Coccidioides immitis [TaxId:246410]
  Gene: CIMG_07932
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CL19 (Start-183)
  Domains in SCOPe 2.07: d3sgwa_
• Heterogens: MLA, EDO, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3sgwA (A:)
  mahhhhhhmgtleaqtqgpgsmaatplpplrlaiacddagvsykealkahlsdnplvssi
  tdvgvtsttdktayphvaiqaaqlikdgkvdralmicgtglgvaisankvpgiravtahd
  tfsverailsndaqvlcfgqrvigielakrlagewltyrfdqksasaqkvqaisdyekkf
  vevn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3sgwA (A:)
  lpplrlaiacddagvsykealkahlsdnplvssitdvgvtsttdktayphvaiqaaqlik
  dgkvdralmicgtglgvaisankvpgiravtahdtfsverailsndaqvlcfgqrvigie
  lakrlagewltyrfdqksasaqkvqaisdyekkfvevn