PDB entry 3sa2

View 3sa2 on RCSB PDB site
Description: Bacuills anthracis Dihydrofolate Reductase bound propargyl-linked TMP analog, UCP1014
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2011-06-02, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Bacillus anthracis [TaxId:1392]
  Gene: BAS2083, BA_2237, dfrA, GBAA2237, GBAA_2237
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q81R22 (3-164)
    • expression tag (0-2)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d3sa2a1, d3sa2a2
• Chain 'B':
  Compound: dihydrofolate reductase
  Species: Bacillus anthracis [TaxId:1392]
  Gene: BAS2083, BA_2237, dfrA, GBAA2237, GBAA_2237
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q81R22 (3-164)
    • expression tag (0-2)
    • engineered mutation (4)
  Domains in SCOPe 2.07: d3sa2b1, d3sa2b2
• Heterogens: NAP, 7DR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sa2A (A:)
  hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
  rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
  hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3sa2B (B:)
  hhhmrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpg
  rrniivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitki
  hhafegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq