PDB entry 3qiu

View 3qiu on RCSB PDB site
Description: Crystal structure of the 226 TCR in complex with MCC/I-Ek
Class: immune system
Keywords: immunoglobulin domain, T cell receptor, MHC molecule, IMMUNE SYSTEM
Deposited on 2011-01-27, released 2011-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-K alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qiua1, d3qiua2
  • Chain 'B':
    Compound: MHC class II h2-ia-beta chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Eb1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qiub1, d3qiub2
  • Chain 'C':
    Compound: TCR 226 alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QIU
    Domains in SCOPe 2.07: d3qiuc1, d3qiuc2
  • Chain 'D':
    Compound: TCR 226 beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3QIU (0-End)
    Domains in SCOPe 2.07: d3qiud1, d3qiud2
  • Chain 'E':
    Compound: MCC peptide
    Species: Manduca sexta [TaxId:7130]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00039 (0-11)
      • expression tag (12)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qiuA (A:)
    eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
    iavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvtwl
    rngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrkhwefe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3qiuB (B:)
    srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
    sqpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptktqplehhnllvcsvsdf
    ypgnievrwfrngkeektgivstglvrngdwtfqtlvmletvpqsgevytcqvehpsltd
    pvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qiuB (B:)
    srpwfleycksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwn
    sqpefleqkraevdtvcrhnyeifdnflvprrveptvtvyptllvcsvsdfypgnievrw
    frkeektgivstglvrngdwtfqtlvmletvytcqvehpsltdpvtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3qiuC (C:)
    mrgdqveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengr
    lksafdskerystlhirdaqledsgtyfcaaepssgqklvfgqgtilkvylhiqnpdpav
    yqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnks
    dfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qiuC (C:)
    qveqspsalslhegtgsalrcnftttmravqwfrknsrgslinlfylasgtkengrlksa
    fdskerystlhirdaqledsgtyfcaaepssgqklvfgqgtilkvylhiqnpdpavyqlr
    dskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsavawsacanafn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3qiuD (D:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllviedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qiuD (D:)
    mkviqtprylvkgqgqkakmrcipekghpvvfwyqqnknnefkflinfqnqevlqqidmt
    ekrfsaecpsnspcsleiqsseagdsalylcasslnnansdytfgsgtrllviedlknvf
    ppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    adsryalssrlrvsatfwqnprnhfrcqvqfyglsdewtqdrakpvtqivsaeawgra
    

  • Chain 'E':
    No sequence available.