PDB entry 3q3g

View 3q3g on RCSB PDB site
Description: Crystal Structure of A-domain in complex with antibody
Class: immune system/cell adhesion
Keywords: immune system-cell adhesion complex
Deposited on 2010-12-21, released 2011-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-219)
    Domains in SCOPe 2.07: d3q3ga1, d3q3ga2
  • Chain 'B':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-223)
  • Chain 'C':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-219)
    Domains in SCOPe 2.07: d3q3gc1, d3q3gc2
  • Chain 'D':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-223)
  • Chain 'E':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3ge_
  • Chain 'F':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-219)
    Domains in SCOPe 2.07: d3q3gf1, d3q3gf2
  • Chain 'G':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3gg_
  • Chain 'H':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-223)
  • Chain 'I':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3gi_
  • Chain 'J':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-219)
    Domains in SCOPe 2.07: d3q3gj1, d3q3gj2
  • Chain 'K':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3Q3G (0-223)
  • Chain 'L':
    Compound: Integrin alpha-M
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAM, CD11B, CR3A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3q3gl_
  • Heterogens: EDO, GOL, NA, CA, CL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q3gA (A:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q3gC (C:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3q3gE (E:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3gE (E:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaie
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q3gF (F:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3q3gG (G:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3gG (G:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaie
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3q3gI (I:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3gI (I:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaie
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3q3gJ (J:)
    diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr
    esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3q3gL (L:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3q3gL (L:)
    dsdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
    npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
    yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
    lrekifaie