PDB entry 3pcy

View 3pcy on RCSB PDB site
Description: the crystal structure of mercury-substituted poplar plastocyanin at 1.9-angstroms resolution
Class: electron transport protein(cuproprotein)
Keywords: electron transport protein(cuproprotein)
Deposited on 1985-12-10, released 1986-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: Populus nigra [TaxId:3691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pcya_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pcyA (A:)
    idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
    dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn