PDB entry 3oxw

View 3oxw on RCSB PDB site
Description: Crystal Structure of HIV-1 I50V, A71V Protease in Complex with the Protease Inhibitor Darunavir
Class: Hydrolase/Hydrolase Inhibitor
Keywords: HIV-1 protease, inhibitor resistance, AIDS, Aspartyl protease, drug resistance, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2010-09-22, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d3oxwa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d3oxwb_
  • Chain 'C':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d3oxwc_
  • Chain 'D':
    Compound: hiv-1 protease
    Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered mutation (6)
      • engineered mutation (49)
      • engineered mutation (70)
    Domains in SCOPe 2.07: d3oxwd_
  • Heterogens: 017, PO4, ACT, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxwA (A:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxwB (B:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxwC (C:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3oxwD (D:)
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggvggfikvrqyd
qipveicghkvigtvlvgptpvniigrnlltqigctlnf