PDB entry 3o19

View 3o19 on RCSB PDB site
Description: Structure-function analysis of human L-Prostaglandin D Synthase bound with fatty acid
Class: isomerase
Keywords: Lipocalin, prostaglandin synthase, ISOMERASE
Deposited on 2010-07-21, released 2010-09-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prostaglandin-H2 D-isomerase
    Species: Homo sapiens [TaxId:9606]
    Gene: PTGDS, PDS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41222 (0-End)
      • engineered mutation (36)
    Domains in SCOPe 2.03: d3o19a_
  • Heterogens: OLA, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3o19A (A:)
svqpnfqqdkflgrwfsaglasnsswlrekkaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl
ysrtqtpraelkekftafckaqgftedtivflpqtdkcmteq

    Sequence, based on observed residues (ATOM records): (download) 
    >3o19A (A:)
svqpnfqqdkflgrwfsaglasnsswlrekkaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrstysvsvvetdydqyallysqgskgpgedfrmatlysrtq
tpraelkekftafckaqgftedtivflpqtdkcm