PDB entry 3nyk

View 3nyk on RCSB PDB site
Description: The structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis
Class: metal binding protein
Keywords: beta-sandwich, red-ox protein, divalent metal-ion, metalloprotein, METAL BINDING PROTEIN
Deposited on 2010-07-15, released 2010-10-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Alcaligenes faecalis [TaxId:511]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3nyka_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nykA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
    sak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nykA (A:)
    enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
    nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia