PDB entry 3nwv

View 3nwv on RCSB PDB site
Description: Human cytochrome c G41S
Class: apoptosis
Keywords: cytochrome, electron transport, Apaf-1, Heme, mitochondia, apoptosis
Deposited on 2010-07-11, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYC, CYC1, CYCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d3nwva_
  • Chain 'B':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYC, CYC1, CYCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d3nwvb_
  • Chain 'C':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYC, CYC1, CYCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d3nwvc_
  • Chain 'D':
    Compound: cytochrome c
    Species: Homo sapiens [TaxId:9606]
    Gene: CYC, CYC1, CYCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P99999 (0-103)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d3nwvd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3nwvA (A:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3nwvB (B:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3nwvC (C:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3nwvD (D:)
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne