PDB entry 3nfu

View 3nfu on RCSB PDB site
Description: Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
Class: lyase
Keywords: lyase, structural genomics, protein structure initiative, psi, nysgrc, new york structural genomics research consortium, nysgxrc, new york sgx research center for structural genomics
Deposited on 2010-06-10, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucarate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2481
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QUN0 (3-441)
      • expression tag (2)
      • expression tag (442)
    Domains in SCOPe 2.07: d3nfua1, d3nfua2, d3nfua3, d3nfua4
  • Chain 'B':
    Compound: glucarate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2481
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QUN0 (3-441)
      • expression tag (2)
      • expression tag (442)
    Domains in SCOPe 2.07: d3nfub1, d3nfub2, d3nfub3, d3nfub4
  • Heterogens: SO4, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nfuA (A:)
    mslfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegiln
    glekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdl
    fgqalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryrea
    mtpeavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawkl
    deavrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyav
    qlnsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgei
    taidthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrn
    damamqylipgwefdpkrpalveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfuA (A:)
    lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl
    ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg
    qalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamt
    peavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawklde
    avrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavql
    nsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeita
    idthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrnda
    mamqylipgwefdpkrpalve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nfuB (B:)
    mslfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegiln
    glekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdl
    fgqalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryrea
    mtpeavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawkl
    deavrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyav
    qlnsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgei
    taidthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrn
    damamqylipgwefdpkrpalveghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nfuB (B:)
    lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl
    ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg
    qalgmpvadllgqygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamt
    peavanlaraaydrygfkdfklkggvlrgeeeadciralheafpearlaldpngawklde
    avrvlepikhllsyaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavql
    nsvdipladchfwtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeita
    idthwiwqdgqritrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrnda
    mamqylipgwefdpkrpalve