PDB entry 3mxe

View 3mxe on RCSB PDB site
Description: Crystal structure of HIV-1 protease inhibitor, KC32 complexed with wild-type protease
Class: hydrolase/hydrolase inhibitor
Keywords: drug design, protease inhibitors, HIV protease, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-05-07, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • engineered mutation (63)
  Domains in SCOPe 2.07: d3mxea_
• Chain 'B':
  Compound: hiv-1 protease
  Species: HIV-1 M:B_ARV2/SF2 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • engineered mutation (63)
  Domains in SCOPe 2.07: d3mxeb_
• Heterogens: K54, PO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mxeA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3mxeB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf