PDB entry 3lua

View 3lua on RCSB PDB site
Description: Crystal structure of a Signal receiver domain of Two component Signal Transduction (Histidine Kinase) from Clostridium thermocellum
Class: Transcription regulator
Keywords: Two-component signal transduction system, Histidine Kinase, Phosphorelay, Receiver domain, 11201g, NYSGXRC, PSI-II, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Transcription regulator
Deposited on 2010-02-17, released 2010-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator receiver protein
    Species: Clostridium thermocellum [TaxId:203119]
    Gene: 4809959, Cthe_3085
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3DK02 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3luaa1, d3luaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3luaA (A:)
    msldgtvllidyfeyerektkiifdnigeydfievenlkkfysifkdldsitliimdiaf
    pvekeglevlsairnnsrtantpviiatksdnpgyrhaalkfkvsdyilkpyptkrlens
    vrsvlkicqrfreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3luaA (A:)
    ldgtvllidyfeyerektkiifdnigeydfievenlkkfysifkdldsitliimdiafpv
    ekeglevlsairnnsrtantpviiatksdnpgyrhaalkfkvsdyilkpyptkrlensvr
    svlki