PDB entry 3kvq

View 3kvq on RCSB PDB site
Description: Crystal structure of VEGFR2 extracellular domain D7
Class: transferase
Keywords: VEGFR2, Angiogenesis, ATP-binding, Developmental protein, Differentiation, Glycoprotein, Host-virus interaction, Immunoglobulin domain, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2009-11-30, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-23, with a file datestamp of 2010-02-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FLK1, KDR, VEGFR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kvqa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3kvqA (A:)
    rqltvlervaptitgnlenqttsigesievsctasgnpppqimwfkdnetlvedsgivlk
    dgnrnltirrvrkedeglytcqacsvlgcakveaffiiegaqektnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >3kvqA (A:)
    ptitgnlenqttsigesievsctaspqimwfkdnetlvedsgivlkdgnrnltirrvrke
    deglytcqaccakveaffiieg