PDB entry 3kku

View 3kku on RCSB PDB site
Description: Cruzain in complex with a non-covalent ligand
Class: hydrolase
Keywords: Autocatalytic cleavage, Glycoprotein, Protease, Thiol protease, Zymogen, HYDROLASE
Deposited on 2009-11-06, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.116
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cruzipain
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3kkua_
  • Heterogens: B95, EDO, Z22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kkuA (A:)
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg