PDB entry 3jtd
View 3jtd on RCSB PDB site
Description: Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
Class: contractile protein
Keywords: Regulated myosins, smooth and molluscan muscle, X-ray crystallographic structure, scallop regulatory domain/lever arm, off-state, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament, Calcium, CONTRACTILE PROTEIN
Deposited on
2009-09-11, released
2009-12-01
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-12-01, with a file datestamp of
2009-11-27.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.233
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Myosin heavy chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: myosin regulatory light chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3jtdb_ - Chain 'C':
Compound: myosin essential light chain, striated adductor muscle
Species: Argopecten irradians [TaxId:31199]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3jtdc_ - Heterogens: MG, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3jtdB (B:)
adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
nkdemrmtfkeapveggkfdyvkftamikgsgeeea
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>3jtdC (C:)
pklsqdeiddlkdvfelfafwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypdk