PDB entry 3il8

View 3il8 on RCSB PDB site
Description: crystal structure of interleukin 8: symbiosis of nmr and crystallography
Class: cytokine
Keywords: cytokine
Deposited on 1990-12-07, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3il8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3il8A (A:)
    sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
    vvekflkraens
    

    Sequence, based on observed residues (ATOM records): (download)
    >3il8A (A:)
    lrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvvek
    flkraens