PDB entry 3hny

View 3hny on RCSB PDB site
Description: Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor
Class: blood clotting
Keywords: BLOOD CLOTTING, Acute phase, Blood coagulation, Calcium, Disease mutation, Disulfide bond, Glycoprotein, Hemophilia, Metal-binding, Pharmaceutical, Polymorphism, Secreted, Sulfation
Deposited on 2009-06-01, released 2010-01-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-04-28, with a file datestamp of 2010-04-23.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.184
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'M':
  Compound: coagulation factor viii
  Species: Homo sapiens [TaxId:9606]
  Gene: F8, F8C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00451 (Start-158)
  Domains in SCOPe 2.03: d3hnym_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'M':
  Sequence, based on SEQRES records: (download)
  

  >3hnyM (M:)
  dlnscsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkew
  lqvdfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqds
  ftpvvnsldpplltrylrihpqswvhqialrmevlgcea
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3hnyM (M:)
  scsmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqv
  dfqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftp
  vvnsldpplltrylrihpqswvhqialrmevlgcea