PDB entry 3hc8

View 3hc8 on RCSB PDB site
Description: Investigation of Aminopyridiopyrazinones as PDE5 Inhibitors: Evaluation of Modifications to the Central Ring System.
Class: Hydrolase
Keywords: PDE5, PDE-5,inhibition, Alternative splicing, cAMP, Hydrolase, Phosphoprotein, Polymorphism Allosteric enzyme, cGMP, cGMP-binding, Magnesium, Metal-binding, Nucleotide-binding, Zinc
Deposited on 2009-05-05, released 2009-07-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cGMP-specific 3',5'-cyclic phosphodiesterase, cAMP-specific 3',5'-cyclic phosphodiesterase 4B
  Species: Homo sapiens [TaxId:9606]
  Gene: PDE5A, PDE5, PDE4B, DPDE4
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76074 (0-121)
  • Uniprot Q07343 (122-145)
  • Uniprot O76074 (147-323)
    • conflict (216)
  Domains in SCOPe 2.04: d3hc8a_
• Heterogens: PD4, ZN, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3hc8A (A:)
  etrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevl
  crwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdl
  dhpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlk
  iikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpi
  qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
  vsedcfplldgcrknrqkwqalae