PDB entry 3gzl

View 3gzl on RCSB PDB site
Description: Crystal Structure of holo PfACP Disulfide-Linked Dimer
Class: biosynthetic protein
Keywords: disulfide dimer, helix bundle, phosphopantetheine, fatty acid biosynthesis, Lipid synthesis, Transit peptide, BIOSYNTHETIC PROTEIN
Deposited on 2009-04-07, released 2009-04-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.242
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: ACP, acpP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gzla_
  • Heterogens: PNS

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3gzlA (A:)
sslkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdq
dalkintvqdaidyieknnkq