PDB entry 3fq0

View 3fq0 on RCSB PDB site
Description: Staphylococcus aureus dihydrofolate reductase complexed with NADPH and 2,4-diamino-5-(3-(2,5-dimethoxyphenyl)prop-1-ynyl)-6-ethylpyrimidine (UCP120B)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2009-01-06, released 2009-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trimethoprim-sensitive dihydrofolate reductase
    Species: Staphylococcus aureus RF122 [TaxId:273036]
    Gene: dfrB, SAB1281c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fq0a_
  • Heterogens: NDP, N22, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fq0A (A:)
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk