PDB entry 3f9d
View 3f9d on RCSB PDB site
Description: Crystal structure of the R132K:R111L:T54E mutant of cellular retinoic acid-binding protein II complexed with C15-aldehyde (a retinal analog) at 2.00 angstrom resolution
Class: transport protein
Keywords: CRABPII, retinal, protonated Schiff base, PSB, C15-aldehyde, retinoic acid, retinoid, Cytoplasm, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on
2008-11-13, released
2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-10-27, with a file datestamp of
2009-10-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellular retinoic acid-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: CRABP2
Database cross-references and differences (RAF-indexed):
- Uniprot P29373 (0-136)
- engineered (53)
- engineered (110)
- engineered (131)
Domains in SCOPe 2.07: d3f9da_ - Chain 'B':
Compound: Cellular retinoic acid-binding protein 2
Species: Homo sapiens [TaxId:9606]
Gene: CRABP2
Database cross-references and differences (RAF-indexed):
- Uniprot P29373 (0-136)
- engineered (53)
- engineered (110)
- engineered (131)
Domains in SCOPe 2.07: d3f9db_ - Heterogens: LSR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3f9dA (A:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikesttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
ltmtaddvvctkvyvre
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3f9dB (B:)
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyikesttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
ltmtaddvvctkvyvre