PDB entry 3esj

View 3esj on RCSB PDB site
Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Class: lyase
Keywords: MECDP-synthase, Isoprene biosynthesis, Lyase, Magnesium, Manganese, Metal-binding
Deposited on 2008-10-06, released 2009-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62617 (6-164)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d3esja1, d3esja2
  • Heterogens: ZN, CC7, MG, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3esjA (A:)
gshmlemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaal
gdigklfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrv
fiaedlgchmddvnvkattteklgftgrgegiaceavallikatk

    Sequence, based on observed residues (ATOM records): (download) 
    >3esjA (A:)
mlemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdi
gklfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfia
edlgchmddvnvkattteklgftgrgegiaceavallikatk